PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395300.1
Common NameCsa_2G352410, LOC101214485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 205aa    MW: 23037.2 Da    PI: 8.2926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.5e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed +l+ +v+ +G   tW + + + g++R++k+c++rw++yl
   Cucsa.395300.1 14 KGPWSPDEDAILKSYVETHGIAgTWIALPTKAGLKRCGKSCRLRWLNYL 62
                     79******************889************************97 PP

2Myb_DNA-binding54.33.2e-1769111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd  + ++++q+G++ W+tIa+ ++ gRt++++k++w++
   Cucsa.395300.1  69 GEFTEEEDNVIFNLFNQYGSR-WSTIASQLP-GRTDNDVKNHWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.236962IPR017930Myb domain
SuperFamilySSF466893.88E-2712109IPR009057Homeodomain-like
SMARTSM007176.4E-91364IPR001005SANT/Myb domain
PfamPF002492.9E-121462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-231569IPR009057Homeodomain-like
CDDcd001675.11E-71662No hitNo description
PROSITE profilePS5129424.84963117IPR017930Myb domain
SMARTSM007171.3E-1567115IPR001005SANT/Myb domain
PfamPF002491.3E-1469111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2470116IPR009057Homeodomain-like
CDDcd001673.42E-1270111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MGRAPCCEKG KVKKGPWSPD EDAILKSYVE THGIAGTWIA LPTKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FTEEEDNVIF NLFNQYGSRW STIASQLPGR TDNDVKNHWN TKLKKKKKKL  120
FLAAKTQSHL HSQSPLLHTQ ETDFTEIINH TPISCIAALD NSVDQFQIPT VSEPGAGSDS  180
RDQWSSMEPW GCDFPADMIC SMLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141167107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111118KLKKKKKK
2112119LKKKKKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818231e-137LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132571e-137LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004142913.11e-154PREDICTED: transcription factor RAX3
SwissprotQ9SJL72e-64RAX2_ARATH; Transcription factor RAX2
TrEMBLA0A0A0LR011e-154A0A0A0LR01_CUCSA; Uncharacterized protein
STRINGGLYMA17G35020.21e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.14e-62MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]